PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast06G239600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family WRKY
Protein Properties Length: 256aa    MW: 27874.8 Da    PI: 7.4557
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast06G239600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.75.1e-33104161259
                         --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         +Dgy+WrKYGqK vk+s+fprsYYrCt ++C+vkk+vers++dp++v++tYeg+H h+
  Brast06G239600.1.p 104 EDGYRWRKYGQKAVKNSPFPRSYYRCTNNKCTVKKRVERSSSDPSIVITTYEGQHCHH 161
                         8******************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.2E-3388162IPR003657WRKY domain
SuperFamilySSF1182902.22E-2895161IPR003657WRKY domain
PROSITE profilePS5081129.98798163IPR003657WRKY domain
SMARTSM007741.5E-38103162IPR003657WRKY domain
PfamPF031066.1E-26104161IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MEWPIFSGDD ESSSALLAEL GWVVDDSALL LPPLELHPPP TPDGSSTDGD GATTPGEPAA  60
AAEAASKPAP APGKKGEQKN NSSSKRARQP RFAFMTKTEI DHLEDGYRWR KYGQKAVKNS  120
PFPRSYYRCT NNKCTVKKRV ERSSSDPSIV ITTYEGQHCH HTATFPRHHF SPHHGHLLYN  180
DDHHQPPPMH GYSSSSSPFF CRPSSSSSSS LLQQLHCNRQ ELQAAASYTT GSSTTAPAVD  240
KGLLDDMVPP AMRHG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-2693160774Probable WRKY transcription factor 4
2lex_A5e-2693160774Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00067PBMTransfer from AT1G69310Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3418593e-76AY341859.1 Oryza sativa (japonica cultivar-group) WRKY19 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010228460.11e-102PREDICTED: probable WRKY transcription factor 57
SwissprotQ9C9839e-56WRK57_ARATH; Probable WRKY transcription factor 57
TrEMBLA0A0Q3K9R41e-102A0A0Q3K9R4_BRADI; Uncharacterized protein
TrEMBLW5BDM01e-102W5BDM0_WHEAT; Uncharacterized protein
STRINGBRADI1G59180.11e-102(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21253796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.28e-53WRKY DNA-binding protein 57